SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396627|ref|YP_001327094.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396627|ref|YP_001327094.1|
Domain Number 1 Region: 199-331
Classification Level Classification E-value
Superfamily CBS-domain pair 1.18e-26
Family CBS-domain pair 0.0031
Further Details:      
 
Domain Number 2 Region: 345-427
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.18e-22
Family CorC/HlyC domain-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150396627|ref|YP_001327094.1|
Sequence length 430
Comment hypothetical protein Smed_1413 [Sinorhizobium medicae WSM419]
Sequence
MAELFVILLLLLINAFFALSEMALVSASKPLLRQMVKQGIPRAEAALRLAEDPGKFLSTV
QVGITLVGILAGAYGGATIAANIAPFLNDIAWISPYGDTVAVALVVTLITFLSVVIGELI
PKQLALRNSEALAMFVARPMALLSRIVAPVVYLFEGAANLSMRIMGMRPEDADHVTEEEV
QAIMAEGVESGAIEKSEHEMLRRIIRLGDRNVKTIMTHRTEVSFIDIQDDLETIGHKIRQ
SGHSRYPVVDGPAGDVIGAVLAKEILNVSQTGKFNIRDYVRDILTLPETASCLKALEAFK
TSSINMAMIVDEYGSTEGIITTADILEAIVGIIPSNYDDSEHALIHLRDDGSYLVDGRTP
IDEIHLQIGIEGIDADSDFETIAGFLVQQLRKSPEEGDTAEAHGYRFEVIDMDGRRIDKI
LVSRAGEALS
Download sequence
Identical sequences A6U9C9
WP_011975569.1.29075 WP_011975569.1.31871 WP_011975569.1.61285 WP_011975569.1.7720 WP_011975569.1.89664 YP_001327094.1.44884 gi|150396627|ref|YP_001327094.1| 366394.Smed_1413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]