SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150396716|ref|YP_001327183.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150396716|ref|YP_001327183.1|
Domain Number - Region: 38-194
Classification Level Classification E-value
Superfamily Porins 0.0147
Family Outer membrane protein transport protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396716|ref|YP_001327183.1|
Sequence length 195
Comment hypothetical protein Smed_1504 [Sinorhizobium medicae WSM419]
Sequence
MRDFRSFAGRGRKAFVVALVLSSASMAGITQASAAEIFDELRFGATASISDGSNQENGAF
PSLTVFFDPLGADSANGLVEKILRPRFHAGASVATSSTGVSEIYSGLSWTADVTERFFVE
IGAGATVHDGNLNDDGSEGPKLGCRLLFREYAAAGYRFDDHWNLSATVEHASNANLCDGP
NDGLTRAGLMLGYEF
Download sequence
Identical sequences A6U9L8
366394.Smed_1504 WP_011975658.1.61285 WP_011975658.1.7720 WP_011975658.1.89664 YP_001327183.1.44884 gi|150396716|ref|YP_001327183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]