SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396765|ref|YP_001327232.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396765|ref|YP_001327232.1|
Domain Number 1 Region: 120-316
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.5e-54
Family D-glucarate dehydratase-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 5-113
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.12e-28
Family Enolase N-terminal domain-like 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396765|ref|YP_001327232.1|
Sequence length 327
Comment mandelate racemase/muconate lactonizing protein [Sinorhizobium medicae WSM419]
Sequence
MPISLKATVEHFPIAGAFTISRGSKTTASVVTCRITEGTVSGWAECVPYARYGESVESVL
SAIESVRPLIEEGMAREDLQEAMKPGAARNAVDCALWDIEAKRRGRTAASLAGIADPMPL
TTAFTLSLAEPEAMGAQAAKHAKRALLKVKVGTADDTARIRAVRKSAPDSRIILDANEGW
TADNIAAHFSACAENGIALIEQPLPAGQDDILAGLPRPVPVCADESVHATQDIKSLADRY
DAVNIKLDKTGGLTEALRMRAAAEALGLKIMIGCMVGSSLAMAPAVLLAQGADFVDLDGP
LLLSKDRSPGLRYEASLVFPAEASLWG
Download sequence
Identical sequences A6U9R7
366394.Smed_1555 WP_011975705.1.61285 WP_011975705.1.7720 YP_001327232.1.44884 gi|150396765|ref|YP_001327232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]