SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396868|ref|YP_001327335.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396868|ref|YP_001327335.1|
Domain Number 1 Region: 50-152
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.00000000000000693
Family N-utilization substance G protein NusG, N-terminal domain 0.0059
Further Details:      
 
Domain Number 2 Region: 163-218
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000792
Family N-utilization substance G protein NusG, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150396868|ref|YP_001327335.1|
Sequence length 219
Comment NusG antitermination factor [Sinorhizobium medicae WSM419]
Sequence
MIMQRSTFDGSPIALQGHDRFADRMRRISDGLLDEGALLTANLRISGGKAPWFALRVWTG
REKTVEKSLDIMAVRSLVPMRKGPDLRRRGRVIEGQMMPVIHGYVLVQMMALSEYLAGLL
GVEHVIDVLGGCERPMRLSDKEVNRFNGLARNGNFDWERPVDLVVRAGEPVLITAGPFCD
RRATVITPSKKGRGDVVVSIDFMGGEVPVTVPLALLKKL
Download sequence
Identical sequences A6UA20
366394.Smed_1663 YP_001327335.1.44884 gi|150396868|ref|YP_001327335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]