SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396872|ref|YP_001327339.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396872|ref|YP_001327339.1|
Domain Number 1 Region: 331-451
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000000108
Family YhhF-like 0.047
Further Details:      
 
Domain Number 2 Region: 125-194
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.000023
Family ParB-like nuclease domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|150396872|ref|YP_001327339.1|
Domain Number - Region: 191-287
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00209
Family KorB DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396872|ref|YP_001327339.1|
Sequence length 507
Comment MT-A70 family protein [Sinorhizobium medicae WSM419]
Sequence
MSDQLPKLGPKAREIVDAVLQAGVYRAEKQSDVVACRSLNGRGLIGRDKKDGTVWYPTAK
LCELAGVTPPEIGQGGEGGTGAPDSRVQPEEGADRLPAPAEIDASPTAYLPPLTRLPHHP
LAALFPMLPDDELRRLAGDIEANGQQEPVWLLDGKILDGRNREAACHLVGIDAWTKEYEG
KDPLGFVLSLNLHRRHLTESQRAMVAARIVDWERGINQSTAGDANLHAREAGRRLSISER
AVKAAKRVRDHGVEALSDAIRDGRISVHAGEALSHLERAAQEEALRLEEKEIIQRAKEIR
QKRQEIRHAVRLTHMAHVAETGSSTAGKVGQKFPVIYADPPWQFGVRSEVTGREKSAENH
YPTMPTDAICALFDEIGAPAKADAVLFLWATNPMLPDAFRVMAAWGFTYVHHWIWDKEVA
GTGYWGRDRHELLLIGRRGDPVSPLPGSQPETVYRERKGRHSAKPDYFAEQIERLYPAMP
RLEMFCRSPRPGWTAWGFEAATEEAAE
Download sequence
Identical sequences A6UA24
gi|150396872|ref|YP_001327339.1| YP_001327339.1.44884 366394.Smed_1667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]