SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396928|ref|YP_001327395.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396928|ref|YP_001327395.1|
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.03e-81
Family ABC transporter ATPase domain-like 0.000000421
Further Details:      
 
Domain Number 2 Region: 236-361
Classification Level Classification E-value
Superfamily MOP-like 3.89e-26
Family ABC-transporter additional domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396928|ref|YP_001327395.1|
Sequence length 361
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI
FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIDRRVARAAEI
LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH
QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN
FFRGEVETKDGRSFVRVGGVAFDVTDYPGQAKLRTGQKVVLGLRPEHVKVDEARDGEATH
QAVVDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDAGSENR
L
Download sequence
Identical sequences A6UA80
WP_011975864.1.61285 WP_011975864.1.7720 WP_011975864.1.89664 YP_001327395.1.44884 366394.Smed_1725 gi|150396928|ref|YP_001327395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]