SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396975|ref|YP_001327442.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150396975|ref|YP_001327442.1|
Domain Number - Region: 475-624
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0208
Family TAP-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150396975|ref|YP_001327442.1|
Sequence length 683
Comment acyltransferase 3 [Sinorhizobium medicae WSM419]
Sequence
MHYRPEIDGLRAVAVIPVLLFHAGFGFISGGFAGVDVFFVISGFLITALIHQEIRSGAFS
VIGFYERRARRLAPALLFVCIACIPFALMWMLPKELNEFGKSLYAANLFAANFFFWDQTN
YFTPDTGLMPLLHTWSLAVEEQFYVVFPLLLISLRRFTEAAALRAVVAVTVLSFGATQLV
VGIDPAANFYLLPSRFWELGLGAAVALSGIAHRELSRSLRECFACFGVFLIGASYLSITE
AQHYPGWATVPVVAGTALVIAFGRRDTLIGKCLSVRPLVAIGLCSYSLYLWHQPVFAFAR
MRMNDSLTPAGCLALISLCFGLAYLSWRYVERPFRNRARFSRTAIFATVASIGSITVAAG
LVLDGSDGLAGHNVELARLAKPSVGLSKDCNAVIDLKCSTSSQPVIAVWGDSFARHLVDG
ILASEPEARLVQLTNNNCGPLTGLAPILPRLDPAWPQKCIGHNKEVQRFLLAHRSIRYVV
LSSPLNQYLAEKTMLLEGRGAVQSDAWIVADSFRASLAWLRSNGFRPVVIAPPPQDGRDS
GLCVARARLLGASAEGCGASFETVRMHDRDVLTVLAGIARDYPVVSFNGYLCDDGRCRTE
DKGVAIFEDHGHFSDEGSRHLGTTLEFYQVFASAAEYGCTAERGRLGAPIRGICNPAEDT
IMVSASANDVFPARSRTGVERAQ
Download sequence
Identical sequences A6UAC7
gi|150396975|ref|YP_001327442.1| 366394.Smed_1772 WP_011975910.1.29075 WP_011975910.1.61285 YP_001327442.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]