SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397093|ref|YP_001327560.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150397093|ref|YP_001327560.1|
Domain Number - Region: 63-115
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00798
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 
Domain Number - Region: 8-45
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 0.0248
Family Acetamidase/Formamidase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397093|ref|YP_001327560.1|
Sequence length 151
Comment hypothetical protein Smed_1891 [Sinorhizobium medicae WSM419]
Sequence
MKITNTQPGPRGINTVNGPVLVEPGQTVEVEIFAREKAHIKASKWFEVEGDYTDNPGVTA
APALNDAAQNVDAELDRLRAQLAERDAELAKLKAQDDQPKTAAEVLAMANDPNVQFMSFK
SAASKLLGDKTPAKKDEIVAALEDLATKPGA
Download sequence
Identical sequences A6UAP5
gi|150397093|ref|YP_001327560.1| 366394.Smed_1891 WP_011976024.1.29075 WP_011976024.1.31871 WP_011976024.1.89664 YP_001327560.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]