SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397135|ref|YP_001327602.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397135|ref|YP_001327602.1|
Domain Number 1 Region: 103-244
Classification Level Classification E-value
Superfamily Nudix 0.000000000271
Family MutT-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397135|ref|YP_001327602.1|
Sequence length 249
Comment NUDIX hydrolase [Sinorhizobium medicae WSM419]
Sequence
MTLLETDRAQWPVEGKIFPVSDIEIEVAAEPHPFHLAEAEKARESWQKEIAVNPHLFDGR
MVLQRSVLVADGRIRARAHIVPYSTFLWWRKTRAPGASHIFGMPMLVSSDDALIAIRMGA
HTANPGRVYSPGGSLEPEDIVDGRCDVARNIAREVKEETGISLSEATAEPGWHAIHMDGT
LTVFRVFRLAATAEDIVARVAEHVASDPHPEIDEAVAIREPEPTAHNYPEFIPPILDWLF
ARIRGQQMA
Download sequence
Identical sequences A6UAT7
366394.Smed_1933 gi|150397135|ref|YP_001327602.1| WP_011976066.1.29075 WP_011976066.1.31871 WP_011976066.1.61285 WP_011976066.1.7720 WP_011976066.1.89664 YP_001327602.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]