SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397148|ref|YP_001327615.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397148|ref|YP_001327615.1|
Domain Number 1 Region: 5-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-75
Family ABC transporter ATPase domain-like 0.00000089
Further Details:      
 
Weak hits

Sequence:  gi|150397148|ref|YP_001327615.1|
Domain Number - Region: 288-347
Classification Level Classification E-value
Superfamily MOP-like 0.00442
Family BiMOP, duplicated molybdate-binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397148|ref|YP_001327615.1|
Sequence length 353
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MAQLILNHLTKDFGAKGPGEGGPAVSDVSLTLRKQGFLALLGPSGCGKTTVLRMIAGFEQ
PTDGSIEFGECRLSDAVRVLPPEKRNMAMVFQSYALWPHMTVAENVGYPLKVRRISGEAW
RSRVAEALSLVRLTAYADRRPSALSGGQRQRVALARCLVQQPDIVLLDEPLANLDQHLRK
AMEETFRAFHERSSATMIYVTHDQAEAMALATDVAVMSEGKLLQVAPPADIYARPEGRVV
GSLIGRGAIVRLRLPEKAGRQLDWPLLQAALAGRRSGHGHAGEGPLSDVLIRPEQVHPDS
GGMPMRVLSSVFEGERSALTLALPDGQSLKAYSNKAFCHGTEVPFVISGGWRL
Download sequence
Identical sequences A6UAV0
gi|150397148|ref|YP_001327615.1| YP_001327615.1.44884 366394.Smed_1946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]