SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150397171|ref|YP_001327638.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397171|ref|YP_001327638.1|
Domain Number 1 Region: 20-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.88e-18
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 81-168
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 8.31e-17
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397171|ref|YP_001327638.1|
Sequence length 172
Comment AsnC family transcriptional regulator [Sinorhizobium medicae WSM419]
Sequence
MKGANFSAHAALKARSRSVLDDRDRKLLMLLQQDASVPMSDLAERVSLSLSACSRRIQRL
EEAGYVSRRIVVLDREKMGVPTTVFALIKTAHHSDDWIEKFRRAISDIPEIVEAHRLTGN
YDYIVKVVLPRVEHYDVVYKQIVRKVELFDVSASISMEVLKSGTAVPVGYAD
Download sequence
Identical sequences A6UAX3
366394.Smed_1969 YP_001327638.1.44884 gi|150397171|ref|YP_001327638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]