SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397232|ref|YP_001327699.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397232|ref|YP_001327699.1|
Domain Number 1 Region: 257-492
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.24e-71
Family Vanillyl-alcohol oxidase-like 0.042
Further Details:      
 
Domain Number 2 Region: 46-251
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-64
Family FAD-linked oxidases, N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397232|ref|YP_001327699.1|
Sequence length 492
Comment D-lactate dehydrogenase [Sinorhizobium medicae WSM419]
Sequence
MWVAQGRLFSVLAKVHRETRRRVLVALKSIAAGVRNETGIAAAKTHLAARFGGRFQTGEA
IRAQHAHTTTYIPAQLPDAVVFPESAAEVCEIVEVACAHRVPLIPFGTGSSLEGHLNAPH
GGISVDMMRMNRVLAVSAEDLDCTVEPGVTREELNTYLRDTGLFFPIDPGANASIGGMAS
TRASGTNAVRYGTMKENVLAVTAVVAGGREIRTAHRARKSSAGYDLTRLFVGAEGTLGII
TSITLRLQGIPEVISGGVCPFPTIADACNAVILTIQSGIPVARIELLDALQMKACNAYSG
LSYQETPTLFVEFHGGGQSVELQSRQFAEIASEFGSPGFIWTTNPEERARLWKARHNAYW
AQKSLMPGRAILSTDVCVPISRLADCVAATHEDIAAYGLVAPIVGHAGDGNFHVGLLFDD
TDAADVARAEAFVERLNARALSMDGTCTGEHGIGQGKMPFLAAELGDALDLMRQIKRSLD
PDNIFNPGKIFI
Download sequence
Identical sequences A6UB34
WP_011976161.1.7720 YP_001327699.1.44884 gi|150397232|ref|YP_001327699.1| 366394.Smed_2031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]