SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397234|ref|YP_001327701.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397234|ref|YP_001327701.1|
Domain Number 1 Region: 304-502
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.85e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 803-1020
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 9.55e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000372
Further Details:      
 
Domain Number 3 Region: 57-151
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.59e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0021
Further Details:      
 
Domain Number 4 Region: 565-663
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.2e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0034
Further Details:      
 
Domain Number 5 Region: 153-198,280-335
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.41e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0058
Further Details:      
 
Domain Number 6 Region: 715-798
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000109
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0015
Further Details:      
 
Domain Number 7 Region: 200-278
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000157
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397234|ref|YP_001327701.1|
Sequence length 1044
Comment acriflavin resistance protein [Sinorhizobium medicae WSM419]
Sequence
MNIGMGGHHPGGGQGGKTGFTALFIRRPIFALVVNTLIVVAGLAAWNGVEIRELPQVDQP
VVSVTTEFDGASPETIDREVTSVVEGAVSRVQGIKDISSTSSFGRSRVTLEFSDTTDIGQ
AANDVRDALGRITGQLPDDADEPRIVKADSDSQPIMRLALTSDTMSMDDMTLLVENEISD
RLAAVEGVADVTVYGDQEKIFRIDVNQAKLAGRGVTVANLREALANASYDVPAGSLTSAN
QDISVRATADLQTPEQFENLMLGNNVRLRDVATVTLGPDTGTSALRSNGREGIGLGIIRQ
AQSNTVDISQGVRSVVNAISSDILPPGTELKVTSDDAVFINGAIHEVEIALFVAVFIVTL
VIYLFLLDWRATLIPTITMPIALIGTVAAIYLAGFSINILTLLAIVLATGLVVDDAIVVL
ENIVRRRAEGLGPRAAAVHGTLEVFFAVLATTATLAAVFVPLSFLPGQTGGLFREFGFVL
AFSILLSSFISLTLCPMLASRMLTKERQEHQGVMQRFGQRASAFYRVTLGACLNAPLIVF
AVAAFFTAAGALGFLTLKSELTPNEDRSQVMLRINAPQGVSLEYTQAQIRRIEEGLQPLL
KSGEISNVFSISGQGGSANSGFMVLTLAQWEERDRTQSQIVADINRMTAKIPSLRAFTIQ
ANSLGIRGAGSGLQVALVGNDYTKLGDAAAKLLRAMEDSGRFENVRLNYEANQAQLSVTI
DRERTSDLGVDIGGLSWALQAMLDGSSVVDIFVEGEAYPVKLLSSTEPLNDPTDLQNIFI
KAGDGRIVPMSSIATIEEKAVAPQLSRESQLRAVSLSAGLKSDLALGEALSMVEEMAEPI
LPPGSRIMPLAEAATLDENANGLFVTFGFAIVIIFLVLAAQFESFVSGLIIMSTVPLGLA
CAIFAMILTGNTLNIYSQIGLVMLVGIMAKNGILIVEFANQLRDRGQDVRSAIENAANIR
LRPVMMTMIATVVGAVPLVLASGAGAEARIALGWVLVGGLGLAVIVTLYLTPVAYLVIAG
FTKPHADEERKLEEEMKAAEVLKI
Download sequence
Identical sequences A6UB36
366394.Smed_2033 gi|150397234|ref|YP_001327701.1| WP_011976163.1.7720 YP_001327701.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]