SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397266|ref|YP_001327733.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397266|ref|YP_001327733.1|
Domain Number 1 Region: 11-520
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.85e-142
Family Arylsulfatase 0.000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397266|ref|YP_001327733.1|
Sequence length 542
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MQPTERALMSKRPNIVLVLADDMGFSDLGCYGGEISTPNLDSLARRGARFTQFYNTARCS
PSRASLLTGLHPHQTGIGILTNNDLPRGYPGNLNLRCATLAEMLKAAGYATCLSGKWHLA
SEMHEPNDTWPTRRGFDRFFGTLTGCGSFYTPGTLTRGECDASAEALDPAFFYTDAIASH
AAEFVTEQSAAGNPFFLYAAFTAPHWPLHAHPGDIDRYRGRFDEGWDVLREKRMKRLVEE
GILTASTAISARDPTQPAWSDTKEKAWQVKRMQAYAAQIERMDRGIGKIIEALKTGGTFE
NTAFIFLSDNGASPEDLPQFDAEKFMRRTDILPRATRDGLPMRVGNTPDICPGAEDTYSS
YGRAWANLSNTPFRFYKRWVHEGGIATPLIVHWPAGGLDCGAILDQPAQLVDIAPTILEV
TGASYPLQAIGREIAPLEGCSLLPALKGEILFERPLYWEHTGNAAIRLGRWKLVREEPNG
WELYDLAADRTELNDVAPGNPEVVADLRAKWEAWAERIGVIPWEVTLGIYEERGLHPTWA
AG
Download sequence
Identical sequences A6UB68
gi|150397266|ref|YP_001327733.1| WP_011976195.1.29075 WP_011976195.1.7720 YP_001327733.1.44884 366394.Smed_2065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]