SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397269|ref|YP_001327736.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397269|ref|YP_001327736.1|
Domain Number 1 Region: 4-387
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.07e-73
Family Arylsulfatase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397269|ref|YP_001327736.1|
Sequence length 491
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MRAIFVLFDSLNRTAVGRYGANAVKTPNFDRFAERATTFDSHFVGSLPCMPARRDLHTGR
LNFMHRSWGPLEPFDNSFPELLGKCGVHSHLITDHLHYFEDGGSTYHTRFRTWDFIRGQE
DDPWKAMVQPPLERFKEMYSEKHYDFDDPWKRMQSAVNREFVRGEHEYPGPRCFKSALEF
LDLNRAADDWFLMVECFDPHEPFAAPERFKEQYATGWEGGVLDWPKYEKVVDSPEEIAEI
RANYAALVTMCDEYFGRLLDYFDEHDLWKDTAIILSTDHGFLLAEHDWWGKNRMPYYAEI
SQIPLIIYHPEHAGGGGTRRSALTQTIDLMPTFLDLFGIDVPQEVQGHSLLPLLKEDRSM
RDVAIFGVFGGPIGSTDGRYTYYLYPEDLYGPDLHEYTLMPMHMTSLFTPEELKTSALTA
GFNFTKNMPVLRIDALRDARRIPNNDRVGWSVDLGTNLVRSSSGPNADAALPGFGDRAPP
VRGNPECAYRP
Download sequence
Identical sequences A6UB71
gi|150397269|ref|YP_001327736.1| YP_001327736.1.44884 366394.Smed_2068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]