SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397281|ref|YP_001327748.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397281|ref|YP_001327748.1|
Domain Number 1 Region: 30-214
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-37
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.00049
Further Details:      
 
Domain Number 2 Region: 208-310
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 4.45e-37
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397281|ref|YP_001327748.1|
Sequence length 324
Comment UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium medicae WSM419]
Sequence
MKQVNGQKLLESLGNGVSAIRGRITPDAPMDRVTWFRAGGLAELMFQPHDTDDLTTFLKL
VPEEVPVLVVGVGSNLLVRDGGIPGVVIRLSAKGFGDLELAGEHRIKAGAICPDKNLAAM
ALDHGIGGFYFYYGIPGSIGGALRMNAGANAGETSARVLEVHAVDRKGDRHVLSKSEMGY
GYRHSGAAKDLIFTHAIFEGYAEDKAKIRNDMDAVRQHRETVQPIREKTGGSTFKNPEGH
SAWKLIDEAGCRGMMIGNAQMSPLHCNFMINTGQATGYELEYLGETVRQRVMDHSGVKLE
WEIKRVGNFMPGYEIKEFLGRATA
Download sequence
Identical sequences A6UB83
gi|150397281|ref|YP_001327748.1| 366394.Smed_2080 WP_011976210.1.29075 WP_011976210.1.31871 WP_011976210.1.61285 WP_011976210.1.7720 WP_011976210.1.89664 YP_001327748.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]