SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397361|ref|YP_001327828.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397361|ref|YP_001327828.1|
Domain Number 1 Region: 6-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-69
Family ABC transporter ATPase domain-like 0.00000234
Further Details:      
 
Domain Number 2 Region: 243-367
Classification Level Classification E-value
Superfamily MOP-like 7.05e-22
Family ABC-transporter additional domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397361|ref|YP_001327828.1|
Sequence length 374
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MNATALSIENVDKFYGPVDHGVHAVKQLNMDVMKGEIIALLGSSGCGKTSTLRMIAGFEP
VSRGTISVAGRQVQTLAPVRRNVAMAFEGYSLYPPLTVRENIAFALKAAKLSQNVVEEKV
ASIAKLLEIEDILGRYPSSISGGQQQRASLGRALIREADLHLLDEPMGQLEPQLRAVLRG
RIKHYIKERGLTAILVTHDQTEANALADRIAVMEGGVLQQFDTPQMIKERPANLFTGTFV
GEPPMNVFEASVSGTEGRVAFGLEDGIRLEYPAADFSHAVRDALMKRKNVVLGIRPYSVR
RSADGVTGRVAVNQWLGDQTHIAADFAGGTMVLVEHDRTNLEIGQPIGIRLDPGSLHVFD
SESGMAISHGEELA
Download sequence
Identical sequences A6UBG3
366394.Smed_2160 gi|150397361|ref|YP_001327828.1| WP_011976290.1.29075 WP_011976290.1.31871 WP_011976290.1.61285 WP_011976290.1.7720 WP_011976290.1.89664 YP_001327828.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]