SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397362|ref|YP_001327829.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397362|ref|YP_001327829.1|
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-73
Family ABC transporter ATPase domain-like 0.0000032
Further Details:      
 
Domain Number 2 Region: 237-358
Classification Level Classification E-value
Superfamily MOP-like 0.00000000000267
Family ABC-transporter additional domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397362|ref|YP_001327829.1|
Sequence length 372
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MTTLQLKNIVKRYKSQTVLDDLSLDVAGGERLVLFGPSGSGKTVLLRLIAGVIEPDAGRV
LIGGEDMTDVDAEHRGIGMAFQNFALFPHMSAFDNIASALTSRKSSKDTIAAGVHKVSKL
LKIDHVLSHHPKALSNGQKQRTALARALVGSPPLLLLDDPLRNVDAKLRFEMRLELPRLL
AAQGATVIYVTQDYKEAMALGDRIAVMAHGRIRQIGTPAEIYNAPADIEIARLFGDPTIN
LLEVVPQRGPDGAFVELSDMRLRLPGFGAEIVGKQCVLGLRPETIAFAEAASQGAIPVTV
EAETPLNEKTVTLGLTARGREILVSRPAGTPGPVAGPAHIAVDGRTAFLFDKATGRRILP
SELASKRNGEAA
Download sequence
Identical sequences A6UBG4
gi|150397362|ref|YP_001327829.1| 366394.Smed_2161 WP_011976291.1.29075 WP_011976291.1.31871 WP_011976291.1.61285 WP_011976291.1.7720 WP_011976291.1.89664 YP_001327829.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]