SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397473|ref|YP_001327940.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397473|ref|YP_001327940.1|
Domain Number 1 Region: 49-201
Classification Level Classification E-value
Superfamily Nudix 6.36e-36
Family MutT-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397473|ref|YP_001327940.1|
Sequence length 210
Comment NUDIX hydrolase [Sinorhizobium medicae WSM419]
Sequence
MSSRPYSADEFRRRALQQAGGPIETAWRDHGDFLLNPGIVPYVESLHLKDAAVLVPVVDD
GDDASVIFTQRTSNLRKHSGQVAFPGGAVDPEDLSIEVAAIREAEEEIGLDPRFVETVAR
LPHYMAMSGFRITPVLAVVQPGFVLEPNPQEVESVFDVPLSFLMNPQNHERGSSHWQGAE
RHFYRMPYGERNIWGITAGIVRMLYERLYA
Download sequence
Identical sequences A6UBS5
gi|150397473|ref|YP_001327940.1| WP_011976400.1.29075 WP_011976400.1.31871 WP_011976400.1.61285 WP_011976400.1.7720 WP_011976400.1.89664 YP_001327940.1.44884 366394.Smed_2273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]