SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397520|ref|YP_001327987.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397520|ref|YP_001327987.1|
Domain Number 1 Region: 10-470
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.94e-136
Family Amylase, catalytic domain 0.000000107
Further Details:      
 
Domain Number 2 Region: 473-515
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000466
Family alpha-Amylases, C-terminal beta-sheet domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397520|ref|YP_001327987.1|
Sequence length 547
Comment alpha amylase [Sinorhizobium medicae WSM419]
Sequence
MAAPSESDDNWWRGAVIYQVYPRSFQDTDGDGMGDLRGVTRRLPHIASLGVDAIWLSPFF
TSPQADMGYDVSDYCDVDPMFGTLDDFDEMMAEAHRLGLKVIIDQVISHTSDRHPWFMES
RSSRTNAKADWYVWADPKPDGTAPNNWLSIFGGPGWEWDGVRRQYYLHNFLSSQPDLNFH
NPEVQEAVLATVRFWLDRGVDGFRLDTANFYFHDRLLRDNPPLVPDPDATSRDAPEVNPY
GMQNHLYDKTQPENIDFLRRFRALLDEYGGRATVGEIGDGSRSLQTVAAYTSGGDKLHMC
YTFDLLGPEFTARHIRRCVESFQATVADGWVCWAFSNHDVMRHVSRFALREADRARVAKL
AISLLATLRGTICLYQGEELGLPEADLAFEELRDPYGIRFWPAFAGRDGCRTPMVWGSEL
KNAGFSDGVPWLPVREGHRTLAVDAQDGVEGSVLEHYRDTLEFRRRRPALVDGDMAFLGT
NQDILVFTREKDGDRLLFVFNLTPEPQTFQLPATLVAEPLPMPGFAPPFADNAITLAALD
VFCGRLR
Download sequence
Identical sequences A6UBX2
gi|150397520|ref|YP_001327987.1| WP_012066543.1.7720 YP_001327987.1.44884 366394.Smed_2320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]