SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150397545|ref|YP_001328012.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397545|ref|YP_001328012.1|
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 3.49e-20
Family Sigma2 domain of RNA polymerase sigma factors 0.0011
Further Details:      
 
Domain Number 2 Region: 100-160
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.49e-16
Family Sigma4 domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397545|ref|YP_001328012.1|
Sequence length 184
Comment RNA polymerase sigma factor [Sinorhizobium medicae WSM419]
Sequence
MSSENQEFKREMLAALPSLRAFAMSLIGRHDRADDLVQDTIMKAWAKQDHFQIGTNMKAW
LFTILRNELYSQMRKRGREVQDSDGHLTETLAHHPEQYGSLDLQDFRRALDQLPPDQREA
IILVGASGFSYEEAATICGCALGTIKSRVNRARQRLQEILQVRGENDYGPDETSAPITSR
AFVS
Download sequence
Identical sequences A6UBZ7
gi|150397545|ref|YP_001328012.1| WP_012066568.1.29075 WP_012066568.1.31871 WP_012066568.1.61285 WP_012066568.1.7720 WP_012066568.1.89664 YP_001328012.1.44884 366394.Smed_2345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]