SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397575|ref|YP_001328042.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397575|ref|YP_001328042.1|
Domain Number 1 Region: 809-1032
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.79e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00017
Further Details:      
 
Domain Number 2 Region: 289-488
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.75e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000347
Further Details:      
 
Domain Number 3 Region: 40-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.4e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0066
Further Details:      
 
Domain Number 4 Region: 138-181,267-312
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000227
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0076
Further Details:      
 
Domain Number 5 Region: 723-810
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000314
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.009
Further Details:      
 
Domain Number 6 Region: 182-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000628
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0083
Further Details:      
 
Domain Number 7 Region: 551-618
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000034
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397575|ref|YP_001328042.1|
Sequence length 1103
Comment acriflavin resistance protein [Sinorhizobium medicae WSM419]
Sequence
MNFSAWSIRNPVAPILAFFVLVVLGWQSFNSLPITRFPNIDVPIVSIAVTQSGAAPAELE
TQVTKEIEDAVAGVTGVDHIESTITDGISTTAVIFRMEVPTTQAVQDVKDAIDRIRSDLP
TSIEEPIVSKVDVEGQAIQTFSVSSPGMTLEELSWFVDDTIKRAIQGQTGIGRVDRYGGS
DREVRVELDEDRLNSFGISAADVNAQLRRMNMDLGSGRGQVGGSEQAIRTLGDTRDVTAL
ADTMIALPNGRFVRLSELGKVIDTYEEPKSFARFNGQPGVTFAVFRAKGASEVSVAETVA
KTLDDIRAKHPDVSIEMVDDSVYFTYGNYEAAIHTLIEGAVLAVIVVMLFLRNWRATLIS
AVALPLSAIPTFWVMELLGFSLNLVSFLAMTLATGILVDDAIVEIENIERHIRMGKSPYR
AAIEAADEIGLAVIATTFTIIAVFVPVSFMPGIPGQYFIQFGLTVAVSVFFSLLVARLIT
PVMAAYLMKPSDASGHDDDEGFMMRQYTRLVRFTTKRWYTRYSTLLAAILLSVGSVIALL
VFVPGSFLPPEDSSRVSLSIELPPDAMLADTDRTTTEIYNRIKDVEGVENVFVLGGASPK
GDLELRRAAVTVLLRKLDHSLINKVVNDVIGRTPLIGEYLPKLPPAGRIIPQSAIEREIF
ARLRSIPDVRVTKLNDRGERDLSFNLLSNNEADLDKAVATLEADLRRDPLLANVSPEGAL
PRPELQIRPRDEQMSRLGITTAQISEVIRIATIGDIDAQLTKIALDGRLIPIRVQLNRDF
RTDLAAIRNLKVQTASGATVPLSSVADINYAEGPSSIKRYDRYRVVKLGADLPAGVALDT
ASARFRQIAADAELPATVQFLESGDAEVQAEMQESFGNAMLLGLMMVLVVLILLFKDVIQ
PFTILFSLPLAIGGVAAALILTQNALSMPVLIGILMLMGIVTKNAILLVDFGIEMMHHGM
DRTLAMIEAGRKRARPIVMTSIAMSAGMLPSALGVGEGGSFRAPMAIAVIGGIIVSTVLS
LVVVPSFFLIMDDLSRLLAWTFGRFIGKKDEEELPLDQEALSKLAAEQGSTIESLEERVK
ALEDEKRRKSDRKVISHPALAAE
Download sequence
Identical sequences A6UC27
366394.Smed_2375 WP_012066598.1.29075 WP_012066598.1.61285 WP_012066598.1.7720 WP_012066598.1.89664 YP_001328042.1.44884 gi|150397575|ref|YP_001328042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]