SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397586|ref|YP_001328053.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397586|ref|YP_001328053.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Urease, beta-subunit 9.55e-47
Family Urease, beta-subunit 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397586|ref|YP_001328053.1|
Sequence length 101
Comment urease subunit beta [Sinorhizobium medicae WSM419]
Sequence
MIPGEIITAAGEIELNAGLETVTIEVANSGDRPVQVGSHYHFAEANPGLLFDRDAARGKR
LDIPAGTAVRFEPGQTRQVTLIPLSGKREVFGFRQQVMGKL
Download sequence
Identical sequences A6UC38
gi|150397586|ref|YP_001328053.1| WP_012066609.1.29075 WP_012066609.1.31871 WP_012066609.1.61285 WP_012066609.1.7720 WP_012066609.1.89664 YP_001328053.1.44884 366394.Smed_2386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]