SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397608|ref|YP_001328075.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397608|ref|YP_001328075.1|
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.82e-87
Family ABC transporter ATPase domain-like 0.000000676
Further Details:      
 
Domain Number 2 Region: 237-343
Classification Level Classification E-value
Superfamily MOP-like 0.000000000000374
Family ABC-transporter additional domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397608|ref|YP_001328075.1|
Sequence length 345
Comment spermidine/putrescine ABC transporter ATPase [Sinorhizobium medicae WSM419]
Sequence
MSGLALQNVVKEFGSFRAVNDVDLTVPHGTFVCMLGPSGCGKTTLLRMIAGLDLPTSGAI
GLDGEDITRVPTHKRNLGMVFQSLALFPHLTVGENIAYPLRIRGAPKEDQRKRVDELLSM
IHLSGYADRPVSKLSGGQRQRVAIARALAISPKLFLLDEPLSALDAKLREAMQVELRQLQ
QKLGITTIVVTHDQREAMTMADTVVVMNGGEIRQAASPIEIYRRPADSFVADFIGQTNLV
EAETDRSGRVTVFGQPVPGLDLPAGAAKAMLSIRPEDVHLTAPGAGALTGTVTFVRDLGG
TIETFVDVAGRQIVAVSTPRARPEVTVGQQVGIGLTPDVCVVLAK
Download sequence
Identical sequences A6UC60
366394.Smed_2408 WP_012066631.1.31871 WP_012066631.1.7720 YP_001328075.1.44884 gi|150397608|ref|YP_001328075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]