SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150397649|ref|YP_001328116.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397649|ref|YP_001328116.1|
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily RmlC-like cupins 4.18e-27
Family TM1459-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397649|ref|YP_001328116.1|
Sequence length 175
Comment cupin [Sinorhizobium medicae WSM419]
Sequence
MPPMKTDPNPRMPYQYPMPTEALPDIVIPDAIPADDRVWVPQGQNVWFRPLCLNRSAGYW
MNLLKVRKSGVLSRHRHPQAVHGFVLKGRWHYLEHDWVAEEGGYVFEPPGETHTLVVPDD
VEEMITFFQVNGIMYYVDAFGEPLGFEDVFTKIDMCRAHYEAVGLGADYVDQFIR
Download sequence
Identical sequences A6UCA1
gi|150397649|ref|YP_001328116.1| 366394.Smed_2449 WP_012066672.1.29075 WP_012066672.1.61285 WP_012066672.1.7720 WP_012066672.1.89664 YP_001328116.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]