SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397652|ref|YP_001328119.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397652|ref|YP_001328119.1|
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.34e-69
Family ABC transporter ATPase domain-like 0.00000153
Further Details:      
 
Domain Number 2 Region: 236-357
Classification Level Classification E-value
Superfamily MOP-like 6.38e-17
Family ABC-transporter additional domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397652|ref|YP_001328119.1|
Sequence length 369
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MYELKSVHKRYGLAKVALRKIDLTVRDREFLVIYGPAGAGKSTLLNILAGISKPTSGDVL
RNGSSILRVPPEKRDAAMAFENYALYSHLSVGENLAFPLKARGFDRAEIEARVKRISGIL
GIGHLLERRPGFLSGGQRQRVALGRAIIRPADIYLLDEPVGHLDAKLRHRIRAELKALAE
DLAATVVFTTTSSREALALGDRIAVLNAGRLEQVGKPADLYHRPANAFVASFVGDPPMSF
ISVQPRRNDGRVDFVTADGMPVASLAAEAVLDLNDEPGSRVQVGFRSNEVRIAQEGDSNA
LRGRVDVIENLGYMKIALVGIGGDQISVSVPAGTPLGVGETVAIAFPRDAIHLFQNARAV
THATPSAGV
Download sequence
Identical sequences A6UCA4
366394.Smed_2452 WP_012066675.1.29075 WP_012066675.1.61285 WP_012066675.1.7720 WP_012066675.1.89664 YP_001328119.1.44884 gi|150397652|ref|YP_001328119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]