SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397695|ref|YP_001328162.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397695|ref|YP_001328162.1|
Domain Number 1 Region: 124-218
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000211
Family Ferredoxin reductase FAD-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397695|ref|YP_001328162.1|
Sequence length 333
Comment siderophore-interacting protein [Sinorhizobium medicae WSM419]
Sequence
MKTTTLIEVHSDLGLQMIKARVVERSLPFVEKSDGLIIHLPLGQIHAFGENGGLRLTLHA
SDHMKLHLLQEAVDHRLDEAAVALDRRWSLTKLGLVPPNLTFAIVESCERVRPSYYRVRL
SGASLERFSRDGLHFRLLFPSENHIGQWPVISESGRVEWPGGISEWHRPVYTTRSVNLEK
GTLDFDVFAHEGGRVTEWCKTLHPGMDAAIMGPGGEWLPDARWIALFGDETALPAIARIL
ESLPEETSGVATILISDAGDVQHLNTTSSVAVRWLVRGDGISLLDELKKLRIPDVDRFVW
IASERSEVNEARNILVARGIQRAEMRVASYWSR
Download sequence
Identical sequences A6UCE7
WP_012066718.1.7720 YP_001328162.1.44884 366394.Smed_2496 gi|150397695|ref|YP_001328162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]