SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397712|ref|YP_001328179.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397712|ref|YP_001328179.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Nudix 7.18e-41
Family MutT-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397712|ref|YP_001328179.1|
Sequence length 135
Comment NUDIX hydrolase [Sinorhizobium medicae WSM419]
Sequence
MQDRNIVLVAACALVDSDGRVLLAQRPQGKPLAGLWEFPGGKVESGETPEETLIRELEEE
LGIRTKVACLAPLTFASHGYDEFHLLMPLYVCRRYEGFAEGREGQAIKWVRPKALRDYPM
PPADEPLIPFLMDLL
Download sequence
Identical sequences A6UCG4
WP_012066735.1.61285 WP_012066735.1.7720 YP_001328179.1.44884 gi|150397712|ref|YP_001328179.1| 366394.Smed_2514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]