SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397841|ref|YP_001328308.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397841|ref|YP_001328308.1|
Domain Number 1 Region: 299-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.76e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000355
Further Details:      
 
Domain Number 2 Region: 844-1039
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.27e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000423
Further Details:      
 
Domain Number 3 Region: 40-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.28e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000618
Further Details:      
 
Domain Number 4 Region: 137-184,277-333
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.51e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0024
Further Details:      
 
Domain Number 5 Region: 685-734,821-870
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.98e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0017
Further Details:      
 
Domain Number 6 Region: 579-684
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.94e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0013
Further Details:      
 
Domain Number 7 Region: 185-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.35e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00035
Further Details:      
 
Domain Number 8 Region: 735-820
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 8.24e-19
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397841|ref|YP_001328308.1|
Sequence length 1058
Comment hydrophobe/amphiphile efflux-1 (HAE1) family protein [Sinorhizobium medicae WSM419]
Sequence
MRFAHFFVDRPIFASVLSIVLLIVGSIAYFQLPIAQYPEIAPPTIVVRASYPGADAETVA
NTVATPLEQEINGVENMLYMSSYATADGSMALTITFKLGTDLDQAQVLVQNRVSIAEPRL
PEEVRRIGVTTTKSSPDLMMVVHLLSPNDRYDQLYVSNYARSRIRDILVRLDGVGDVLLF
GEREYALRVWLDPQKLSAYGMTAGDVVEALRQQNVQVSGGSIGGPPMSSDSAFQYTVTTD
GRFGDARQFRYVIVKATDEGRLVQLQDVARIELGAREYVTNSYLNGSPAVALGIFSRPGS
NALAAADAIQATMADLSRDFPEGLEYRIIYNPTEFISESINEVYKTIAEAALLVALVVII
FLQSWRTAIIPIVAIPVSLVGTFALLFAFGFSLNMLTLFGLVLAIGIVVDDAIVVVENVE
RNLAKGLSPREAAHVTMDEVGAAVIAISLVLTAVFVPTAFIPGISGQFYLQFAVTIAVAT
VISAINSLTLSPALAAILLRPHENHGHESRNPLTRLGRGFANGFNRGFDRMADGYAWTVR
HLVTTRIALAGSLVVFVALLGATWYMAQIVPRGFIPTMDQGYAIVVIQLPDGASLERTDK
VVRRASEIIREVPGVKDAVAFAGFNGATFTNASNSGVIFTPFNSFEERLERKQSSEQIIG
QIFGAMQGIQEAFIIAVPPPSVRGIGNSGGFKMQIMDRQSADMRRALGLAHQMMGAANQT
EGLTGVFTTFSASSPQFFLAIDRDKARALNVPIPNIFETLSINLGTSYVNDFNAFGRVYQ
VRAQADQQFRLEREDILALKVRSATGALVPLGTLVEIRDTSGPALVQRYNMYVSVPLQGN
PAPGVSTGDALDKMEALAGQILPQGTTFEWTELALQERQTGNTAVFIFALSVVFVFLALS
AQYESWVLPLAIILIVPLAVLAALLGVSIRGFDNNVLTQIGLIVLIGLAAKNAILIVEFA
RQGEEEGKTPVEAAIDASRLRLRPILMTAFAFILGVVPLVIATGPGAEMRQSLGTAVFSG
MLGVTFLGLFLTPVFYVALRSLRRKRAPAAEAVPAPGE
Download sequence
Identical sequences A6UCU3
WP_012066862.1.7720 WP_012066862.1.89664 YP_001328308.1.44884 366394.Smed_2643 gi|150397841|ref|YP_001328308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]