SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397846|ref|YP_001328313.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397846|ref|YP_001328313.1|
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 1.83e-22
Family Cell division protein ZapA-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397846|ref|YP_001328313.1|
Sequence length 125
Comment hypothetical protein Smed_2648 [Sinorhizobium medicae WSM419]
Sequence
MAQVTVTIDGKAYRMACEEGQEDHLSDLATRFDQYVGHLKAQFGEIGDLRLTVMAGIMVM
DELSEVNRRLKSIEAEVDDLKRGRDTALSDQTRSEEALAFALGEVTAQIQDIAAKLNGRP
IPPAN
Download sequence
Identical sequences A6UCU8
366394.Smed_2648 WP_012066867.1.31871 WP_012066867.1.7720 YP_001328313.1.44884 gi|150397846|ref|YP_001328313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]