SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397877|ref|YP_001328344.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397877|ref|YP_001328344.1|
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily SMc04008-like 6.02e-38
Family SMc04008-like 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397877|ref|YP_001328344.1|
Sequence length 101
Comment hypothetical protein Smed_2679 [Sinorhizobium medicae WSM419]
Sequence
MTELTPNQSTAFEAAAFRRLLEHLRERSDVQNIDLMNLAGFCRNCLSNWYREAAEASGVT
MSKDESREIVYGMPYDEWRARNQKEASAEQNAAFERNRPKE
Download sequence
Identical sequences A6UCX9
366394.Smed_2679 gi|150397877|ref|YP_001328344.1| WP_012066895.1.29075 WP_012066895.1.31871 WP_012066895.1.61285 WP_012066895.1.7720 WP_012066895.1.89664 YP_001328344.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]