SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397907|ref|YP_001328374.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397907|ref|YP_001328374.1|
Domain Number 1 Region: 106-320
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.75e-17
Family Acetylhydrolase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397907|ref|YP_001328374.1|
Sequence length 416
Comment hypothetical protein Smed_2709 [Sinorhizobium medicae WSM419]
Sequence
MMTTRYRGKGLRLLRLAPVMIGAIAMIAAGLFATAAEAQEPVPRRNVLQRLFGVFTPQRR
VYHQDQYDFRRQPRPQRIQKRRPQPSETRQSRPSRSKARPVAAPPPPPVVVEKSPNAKKV
LVVGDFVAGSLGDGLKAAFETTPGIVIETRANGSSGVVRNDYFDWPKAMSDYIAEIKPAV
IVVSLGANDRQLMRIGETREKFRTNAWMEEYRKRVAALATLARKDELPVLWVGMPPFQST
SMTADMVTFNGIYREEVEKVGGQFIDIWDGFVDEDGKFVLTGSDINGQQVRLRGSDGINL
TKAGKRKLAFYVERDIRRLLGEAAAATDVPGAEGLKDLVVSKPLANEDIIKTQPISLIDP
ELDGATALLGGDTPLKSTGKSPRDRLVEKGEVVAAPPGRIDDFRLAKQGPPGSSTR
Download sequence
Identical sequences A6UD09
366394.Smed_2709 WP_012066925.1.29075 WP_012066925.1.7720 WP_012066925.1.89664 YP_001328374.1.44884 gi|150397907|ref|YP_001328374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]