SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397938|ref|YP_001328405.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397938|ref|YP_001328405.1|
Domain Number 1 Region: 184-628
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.86e-109
Family Amylase, catalytic domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 128-230
Classification Level Classification E-value
Superfamily E set domains 2.62e-29
Family E-set domains of sugar-utilizing enzymes 0.0000465
Further Details:      
 
Domain Number 3 Region: 636-734
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.06e-29
Family alpha-Amylases, C-terminal beta-sheet domain 0.00033
Further Details:      
 
Domain Number 4 Region: 26-123
Classification Level Classification E-value
Superfamily E set domains 8.4e-16
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397938|ref|YP_001328405.1|
Sequence length 736
Comment glycogen branching protein [Sinorhizobium medicae WSM419]
Sequence
MTVPPGQDPAPAPSGTLPAPEIAAILSGTHSDPFAVLGVHAAGKTFVARCFIPGAETVVA
ETLAGNELGTLVRRDEAGFFEGPVALSKEQPVRYRARNGGGEWTVIDPYSFGPVLGPMDD
YYIREGSHLRLFDKMGAHPISHEGAEGFHFAVWAPNARRVSVVGNFNEWDGRRHVMRLRV
DTGIWEIFIPGVPVGTPYKYEIVDRQGTLLPLKADPFARRSELRPDTASMTAAEIAQVWE
DEAHRRHWAELDPRRQPISIYEVHAASWQRRDNGDMLSWDELAERLIPYCVDMGFTHIEF
LPISEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGLGVILDWVPAHFPTDEH
GLRWFDGTALYEHADPRQGFHPDWNTAIYNFGRQEVVAFLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRKHGEWVPNEYGGNENLEAVRFLQTMNSSIYGIHQGVLTIAEESTSWPKV
SHPVHAGGLGFGFKWNMGFMHDTLQYLAREPVHRKFHHNDLTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYGFMWGYPGKKLLFMGQEFAQWREWSEDRALDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGDGFEWLIADDRQNSVFAWLRKAPGE
KLVAVITNFTPVYREHYDIPLPVAGRWKEILNTDAEIYGGSGKGNGGAVIAEKRANGETI
ATITLPPLAALMLEQD
Download sequence
Identical sequences A6UD40
gi|150397938|ref|YP_001328405.1| WP_012066955.1.29075 WP_012066955.1.7720 YP_001328405.1.44884 366394.Smed_2740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]