SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397942|ref|YP_001328409.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397942|ref|YP_001328409.1|
Domain Number 1 Region: 134-453,482-554
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.73e-103
Family Amylase, catalytic domain 0.00000695
Further Details:      
 
Domain Number 2 Region: 8-126
Classification Level Classification E-value
Superfamily E set domains 9.6e-32
Family E-set domains of sugar-utilizing enzymes 0.0047
Further Details:      
 
Domain Number 3 Region: 562-630
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000528
Family alpha-Amylases, C-terminal beta-sheet domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150397942|ref|YP_001328409.1|
Sequence length 654
Comment glycogen debranching protein GlgX [Sinorhizobium medicae WSM419]
Sequence
MPTTGFPPLGVTRAADGTRFTVWSHNAARIDLCLFDGAGMAELSRLPMLRDGDVHSIILP
DIAPGTRYGLRADGVYSPDHGLWFDPSKLLVDPYAVELDGPFRHDPRLTAFGEDTADLVP
KAVVTEAKTVKPGPPLFSSGALIYEVAVKPFTILHPGVPEKKRGTVAALAEPAIIEHLTR
LGVSAVELMPVVAWIDERHLPPLGLRNGWGYNPIAPMALDPRLVPGGIRELRETVDALHQ
AGIGVILDLVFNHSGESDRFGATLSMRGLDNLTYYRHATGRPGELINDTGCGNTIACDHP
VVQRLIVDSLRHFVLAAGIDGFRFDLASILGRDMGGFRRDAALFSAMAADPVLCDRVFIA
EPWDTGPGGYQLGNFPPPFLEWNDRARDDIRRYWRGDRHTVGAFATALAGSSASFSRWGE
TDTRSLNFIAAHDGFTLMDLVSYARKHNEANGEGNRDGHDENFSWNNGAEGPVTDPEIAS
FRQRDVMALLSTLFASRGAIMMRAGDEGGHSQGGNNNAYAQDNAVTWLDWSKPDGTLVEH
SARLSAMRRRFGVFAETAFFTGIDDVAWLCLDGEPLTVEQWEHPATDNLVMMLATEDRHQ
KKATRLAVVVNRSHAPHPIRLPANLKNEWRDALSDGPAPASVPARSVTFLVEFF
Download sequence
Identical sequences A6UD44
366394.Smed_2744 gi|150397942|ref|YP_001328409.1| WP_012066959.1.29075 WP_012066959.1.61285 WP_012066959.1.7720 WP_012066959.1.89664 YP_001328409.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]