SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397958|ref|YP_001328425.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397958|ref|YP_001328425.1|
Domain Number 1 Region: 11-49
Classification Level Classification E-value
Superfamily Bacterial aa3 type cytochrome c oxidase subunit IV 0.000000000000471
Family Bacterial aa3 type cytochrome c oxidase subunit IV 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397958|ref|YP_001328425.1|
Sequence length 74
Comment aa3 type cytochrome c oxidase subunit IV [Sinorhizobium medicae WSM419]
Sequence
MAEHHSGPVETGAPMDYSEHEKTYNFFVNATKYGTLFCIALLIAMAAAFFTTMGFFSSLV
LFILINVGGYFFLR
Download sequence
Identical sequences A6UD60
366394.Smed_2760 gi|150397958|ref|YP_001328425.1| WP_012066975.1.29075 WP_012066975.1.61285 WP_012066975.1.7720 WP_012066975.1.89664 YP_001328425.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]