SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150397962|ref|YP_001328429.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397962|ref|YP_001328429.1|
Domain Number 1 Region: 64-335
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.96e-75
Family L-arabinose binding protein-like 0.0000426
Further Details:      
 
Domain Number 2 Region: 4-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000197
Family GalR/LacI-like bacterial regulator 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397962|ref|YP_001328429.1|
Sequence length 340
Comment alanine racemase [Sinorhizobium medicae WSM419]
Sequence
MAQKVKLSTIAETLGLSTATVSLALRDSPLVAAVTRDKIKEQARALGYIYNRRAASLRTS
RSGIIGVVVHDIMNPFYGEILKAIEAELDRDKQTFILSNHYDSVEKQRDFIETLLQLGGD
GVIMSPAIGTPPQDIQLAEDNNMPAILIARSIEGLDVPIFRGDDAYGIALATNHLIGLGH
RCIAMVGGTDQTSTGRDRYQGYVNALRKANIDVDPDLRIPGPRSKQGGFEAAVHLLSLPQ
KPTAVVCWNDLVAIGMMNGIARAGLVPGVDISVTGYDDLEEASIATPALTTVWNGQAEVG
RSAARALLDKLSGSHEPDGIHLIKPEMRIRQSTGPLRVTA
Download sequence
Identical sequences A6UD64
WP_012066979.1.29075 WP_012066979.1.31871 WP_012066979.1.61285 WP_012066979.1.7720 WP_012066979.1.89664 YP_001328429.1.44884 gi|150397962|ref|YP_001328429.1| 366394.Smed_2764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]