SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398068|ref|YP_001328535.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398068|ref|YP_001328535.1|
Domain Number 1 Region: 923-1249
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.09e-132
Family Methionine synthase SAM-binding domain 0.0000000176
Further Details:      
 
Domain Number 2 Region: 24-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.22e-114
Family Homocysteine S-methyltransferase 0.00000922
Further Details:      
 
Domain Number 3 Region: 371-645
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.09e-89
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.003
Further Details:      
 
Domain Number 4 Region: 763-914
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 6.28e-42
Family Cobalamin (vitamin B12)-binding domain 0.00000211
Further Details:      
 
Domain Number 5 Region: 666-753
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.29e-27
Family Methionine synthase domain 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150398068|ref|YP_001328535.1|
Sequence length 1257
Comment B12-dependent methionine synthase [Sinorhizobium medicae WSM419]
Sequence
MSASDDLFGHVSPKPDGSEIFRQLAQAAAERILIMDGAMGTEIQQLGFVEDHFRGERFGA
CNCHQQGNNDLLTLTQPKAIEEIHYHYAIAGADILETNTFSSTRIAQADYGMEDMVYDLN
RDGARLARRAARRAEAEDGRRRFVAGALGPTNRTASISPDVNNPGYRAVSFDDLRLAYSE
QVRGLIDGGADIILIETIFDTLNAKAAIFATQEVFAEKAVHLPIMISGTITDLSGRTLSG
QTPTAFWYSVRHASPFTIGLNCALGANAMRAHIDELSAIADTLVCAYPNAGLPNEFGQYD
ESPEQMAAQIEGFARDGLVNVVGGCCGSTPAHIRAIAEAVAKYPPRRVPETERLMRLSGL
EPFTLTDEIPFVNVGERTNVTGSAKFRKLITAGDYAAALEVARDQVANGAQIIDVNMDEG
LIDSKQVMVEFLNLVASEPDIARVPVMIDSSKWEVIEAGLKCVQGKALVNSISLKEGEEA
FLYHARLVRAYGAAVVVMAFDEKGQADTKTRKVEICRRAYRLLTEEVGFPPEDIIFDPNI
FAVATGIEEHDNYGVDFIEATHEIVAALPHVHISGGVSNLSFSFRGNEPVREAMHAVFLY
HAIQAGMDMGIVNAGQLAVYDAIDAELREACEDVVLNRRSDGTERLLEIAERYRGQGGSQ
GREKDLAWREWPVEKRLEHALVYGITEFIEADTEEARLSAERPLHVIEGPLMAGMNVVGD
LFGSGKMFLPQVVKSARVMKQAVAVLLPHMEAEKRANGGGEARESAGKILMATVKGDVHD
IGKNIVGVVLACNNYEIIDLGVMVSSARILEVAREQKVDIIGLSGLITPSLDEMAHVASE
LEREGFDLPLLIGGATTSRVHTAVKINPRYSLGQTVYVTDASRAVGVVSSLLSPEVRDGY
KETIRAEYLKVAEAHARNEAEKRRLPLSQARANAVKIDWEAHRPKVPSFLGTRVFDGWDL
AELARYIDWTPFFQTWEMKGVYPRILDDEHQGAAARQLFEDAQAMLAQIVAEKWFAPKAV
VGFWPAGSVGDDVRLFTDETRKGELATLFTLRQQLVKRDGRPNVALADFVAPAESGKRDY
AGAFVVTAGIEEVAIAERFERANDDYSSIMVKALADRFAEAFAERMHEYVRKELWGYAAD
EAFTPQELIGEPYAGIRPAPGYPAQPDHTEKETLFRLLNAEAAIGVKLTESYAMWPGSSV
SGLYIGHPDSYYFGVAKIERDQVEDYAERKQMSVREVERWLSPVLNYVPAPEAEAAE
Download sequence
Identical sequences A6UDH0
YP_001328535.1.44884 gi|150398068|ref|YP_001328535.1| 366394.Smed_2870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]