SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398079|ref|YP_001328546.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398079|ref|YP_001328546.1|
Domain Number 1 Region: 1-165
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 8.83e-49
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000488
Further Details:      
 
Domain Number 2 Region: 170-265
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 9.03e-18
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398079|ref|YP_001328546.1|
Sequence length 265
Comment carbon monoxide dehydrogenase [Sinorhizobium medicae WSM419]
Sequence
MYETNYHRAASIEEAAKLMGTVAEGKYLSGGMTLIPTMKQRLAAPSDLVDLRHIAEMKGV
TVDGRAVRIGAATTHEEVATSAAIAAVCPAICGLASHIGDPHVRHMGTIGGSIANNDPAA
DYPAAMLALDAVIMTDRRELRAENFFTGLFETALEEDEIVTAVRFEAPVKAAYQKFANPA
SRYAMTGVFVARRDDGVVRVAVTGAGSSGVFRHQGLETALSANWSPAAVANVTVDDSDLL
SDIHASAAYRANLVKVMAKRAVAAA
Download sequence
Identical sequences A6UDI1
366394.Smed_2881 gi|150398079|ref|YP_001328546.1| WP_012067094.1.29075 WP_012067094.1.61285 WP_012067094.1.7720 YP_001328546.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]