SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398103|ref|YP_001328570.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398103|ref|YP_001328570.1|
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.33e-66
Family ABC transporter ATPase domain-like 0.00000421
Further Details:      
 
Domain Number 2 Region: 243-346
Classification Level Classification E-value
Superfamily MOP-like 0.00000000000000454
Family ABC-transporter additional domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150398103|ref|YP_001328570.1|
Sequence length 356
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MARINLEHIRHAYGAKPKSESDYALKEVHHEWNDGGAYALLGPSGCGKTTLLNIISGLIN
PSEGRILFDGTDVTHLTTQQRNIAQVFQFPVIYDTMTVYDNLAFPLRNRRVPETEVDRRV
KEILEMTGLVSWAKKTARGLTADQKQKISLGRGLVRSDVSAILFDEPLTVIDPEMKWVLR
SQIKRLHKQFGFTMVYVTHDQTEALTFADKVVVMYDGQIVQIGTPAELFERPRHTFVGYF
IGSPGMNVLPAEIAGSTASIGDQRIALDFRPEVKAGTKTELGIRPEFISLGREGMPVAVT
KVEDIGRHKVVRARFADRPISIIVDEDGEIPAEPRVTFDPKAINIYADSWRVGGEA
Download sequence
Identical sequences A6UDK5
WP_012067117.1.29075 WP_012067117.1.61285 WP_012067117.1.7720 WP_012067117.1.89664 YP_001328570.1.44884 gi|150398103|ref|YP_001328570.1| 366394.Smed_2905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]