SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398151|ref|YP_001328618.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150398151|ref|YP_001328618.1|
Domain Number - Region: 14-48
Classification Level Classification E-value
Superfamily YefM-like 0.000497
Family YefM-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398151|ref|YP_001328618.1|
Sequence length 88
Comment hypothetical protein Smed_2954 [Sinorhizobium medicae WSM419]
Sequence
MPESRPNTSSPRRVGVREFRGNLTSFLQQVQDGQRFVLTSHHKVVAEIGPPSSDVGARKP
GALRGRIKIADDFDSLPADLLKAMEDGA
Download sequence
Identical sequences A6UDQ3
gi|150398151|ref|YP_001328618.1| 366394.Smed_2954 WP_012067165.1.29075 WP_012067165.1.7720 YP_001328618.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]