SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398212|ref|YP_001328679.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398212|ref|YP_001328679.1|
Domain Number 1 Region: 176-393
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.6e-59
Family Divergent polysaccharide deacetylase 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398212|ref|YP_001328679.1|
Sequence length 399
Comment hypothetical protein Smed_3017 [Sinorhizobium medicae WSM419]
Sequence
MATDLNAPLGQNRKERRAHKRDLRRLLRYSGLSLAAVAIMGLSAWSALFPVPLTRSPAAP
TVAEANPVAEASSSGAPVTSPSPLKRSGALSGADVEEVLTDHGATVRKYTPRPRETGGPA
FIDVGSTRGQDPRMAALPNESLLEDRPEGRLPIIGPDGLRPMEQYARPWSGARGTRIAIV
VGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEILLQVPMEPFDAPD
NDPGPPALRVSADARENLAQLHRSMGQITNYTGVMNYLGGRFLSNADALEPVMRDLGKRG
LLFLDDGTSAQSLSGTLAGAFDVPHGFADVVLDSELSRSTILRRLDDLERIARKGGTAIG
VASAFDESVTSIAEWIEEAGGRGIEVVGVAALVKDPKHN
Download sequence
Identical sequences A6UDW4
gi|150398212|ref|YP_001328679.1| WP_012067225.1.29075 WP_012067225.1.61285 WP_012067225.1.7720 YP_001328679.1.44884 366394.Smed_3017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]