SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398266|ref|YP_001328733.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398266|ref|YP_001328733.1|
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily LigT-like 2.96e-42
Family 2'-5' RNA ligase LigT 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398266|ref|YP_001328733.1|
Sequence length 195
Comment 2'-5' RNA ligase [Sinorhizobium medicae WSM419]
Sequence
MPRLFTALEIPRNAAMSLSLLRGGLPGARWIDVENYHITLRFIGDVDWRTADEIIDRLDR
IERPEFQLQLSGTGAFGSKKPHSVWAGVSAVPEMFALQAEIERICQRIGLPSDPRKFTPH
VTLARLRSSRVEDVVEYLSGRGNFVTAPFTVSRFVLLSSRDSVGGGPYLTEEVFPLHEER
SSLSSTDKHPASSAW
Download sequence
Identical sequences A6UE18
gi|150398266|ref|YP_001328733.1| 366394.Smed_3072 WP_012067279.1.29075 WP_012067279.1.31871 WP_012067279.1.61285 WP_012067279.1.7720 WP_012067279.1.89664 YP_001328733.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]