SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398295|ref|YP_001328762.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398295|ref|YP_001328762.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.82e-47
Family Ribosomal protein L19 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398295|ref|YP_001328762.1|
Sequence length 177
Comment 50S ribosomal protein L19 [Sinorhizobium medicae WSM419]
Sequence
MNIIQQLEAEQAAKIAAKRTLPEFSPGDTVRVNVRVVEGTRTRVQAYEGVCIARSGGGIN
ESFTVRKISYGEGVERVFPVYSPLVESVDVVRRGKVRRAKLYYLRDRRGKSARIVENTGT
RARKLNDAERQAISEEKARIEAEKVAAAQALAAEKAAAEAAEAKAAEEAKAAEAAAE
Download sequence
Identical sequences A6UE47
WP_012067308.1.29075 WP_012067308.1.31871 WP_012067308.1.61285 WP_012067308.1.7720 WP_012067308.1.89664 YP_001328762.1.44884 gi|150398295|ref|YP_001328762.1| 366394.Smed_3101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]