SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398338|ref|YP_001328805.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398338|ref|YP_001328805.1|
Domain Number 1 Region: 3-439
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.09e-107
Family Arylsulfatase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398338|ref|YP_001328805.1|
Sequence length 489
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MNKPNVLFIFSDQHAQKVAGCYGDDVVRTPNIDRLAQEGVRFDNAYCPSPICTPSRMSML
TARWPHRQECWTNDDMLRSDVPTWLHRAGEAGYRPALIGRMHSIGPDQLHGYAERGIGDH
TPNFAGIARFPMGVLEGTNEPDSVSLTQSGAGMAIYQRKDQDVVDAAAAWLRDKGAARNA
AGQQFCLTVGLMTPHAPYVVDREAFDHYHGQVPPPRLDVPQDEHDWHRWWRHDRGIGEVS
DAVRDRARAAYWGLVQRTDEMIGQVLDALKEIGAMDDTLIVYASDHGDHVGERGLWWKHT
FFEESVKFPLVMRLPGAIPAGESRDQVVNLVDLSQTMIEVMGAQPLPYADGKSFWAVACD
REAPWENETFSEYCTDPVPSWTGGRAVQQRMIRSGSWKLSVYDGEPPLLFDLSTDPDERI
NRAEDPDCAEMFQRLSARLAHDGWRPETVAARMRERRAEKDILAAWAREVQPAQTHVWEY
TADMNRLDN
Download sequence
Identical sequences A6UE90
366394.Smed_3146 WP_012067351.1.7720 YP_001328805.1.44884 gi|150398338|ref|YP_001328805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]