SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398350|ref|YP_001328817.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398350|ref|YP_001328817.1|
Domain Number 1 Region: 5-218
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.04e-56
Family FAD-linked oxidases, N-terminal domain 0.0089
Further Details:      
 
Domain Number 2 Region: 192-443
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.63e-26
Family D-lactate dehydrogenase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398350|ref|YP_001328817.1|
Sequence length 473
Comment FAD linked oxidase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MIDEHHIDALEKLLGDKGIVTGREDMEAYETGARYDRGRAAAVLRPATTEEASAAVGYCV
RNGIALVPQAGNTGLVSGSTPDGSGEEVVLSLDRLTRRFALDPDNRSVRVDAGFRLSELN
RRLEEYELFFPIDLGADPRIGGMVATNTGGSRFLKYGDVRRNILGLKVVLADEAGTVLDL
HSDLRKNNTGVDWKQIFIGTSGAFGIVTECVLNLERLPKQTATAFLVPASGAHVLPLLKA
MEERLGAYLSAFEGMSKNAIAGALAHVPSLKNPFPGGNVPEYVILAEISRSWAPRDGEQP
LDAVLESVLAEIWETEEAPLADALVGPPHEVWALRHALSEGVKHLGKLIAFDLSFRRGDI
MTFCDHMKAEMPQKFPAVTICDFGHIGDGGVHFNVVVAKDSPLLADAAFEQHLREWVVAI
AVEQYHGSFSAEHALGRRNQAFYDFYTPEKLKNIAAGLKTLTSPGKLGSVRFG
Download sequence
Identical sequences A6UEA2
WP_012067363.1.29075 WP_012067363.1.61285 WP_012067363.1.7720 WP_012067363.1.89664 YP_001328817.1.44884 366394.Smed_3158 gi|150398350|ref|YP_001328817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]