SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398359|ref|YP_001328826.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398359|ref|YP_001328826.1|
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-86
Family ABC transporter ATPase domain-like 0.000000321
Further Details:      
 
Domain Number 2 Region: 236-369
Classification Level Classification E-value
Superfamily MOP-like 1.04e-24
Family ABC-transporter additional domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398359|ref|YP_001328826.1|
Sequence length 370
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MSFLKITNLRKSYGALEILKDINLEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDI
AINGRSVAGLHPSKRDIAMVFQSYALYPNMTVAGNIAFGMEIRGVPKEEREKAIRQVADM
LQIGHLLERKPSQLSGGQRQRVAMGRALVREPQVFLFDEPLSNLDAKLRVDMRTEIKRLH
HRMKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPAEIYNDPANMFVADFMGSPAMN
LVKARIEAADSQVAVTLARPNAEPLKLAVPHNGALSAYAGREVIFGIRPEALTDPDGADR
NAKFVAEGECLIEVVEPAGSDTFAVTRLGGKEIIARLRADARIAPGQTARLAFNLDKAVF
FDTESEKRIA
Download sequence
Identical sequences A6UEB1
WP_012067372.1.29075 WP_012067372.1.31871 WP_012067372.1.61285 WP_012067372.1.7720 WP_012067372.1.89664 YP_001328826.1.44884 366394.Smed_3167 gi|150398359|ref|YP_001328826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]