SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398393|ref|YP_001328860.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398393|ref|YP_001328860.1|
Domain Number 1 Region: 41-175
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.2e-33
Family ParB-like nuclease domain 0.00033
Further Details:      
 
Weak hits

Sequence:  gi|150398393|ref|YP_001328860.1|
Domain Number - Region: 205-280
Classification Level Classification E-value
Superfamily Indigoidine synthase A-like 0.00942
Family Indigoidine synthase A-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398393|ref|YP_001328860.1|
Sequence length 296
Comment parB-like partition protein [Sinorhizobium medicae WSM419]
Sequence
MNDDSSKRRLGRGLAALIGEMDQPLQTGSAPVSPVSADRRIPIEFVSRNPRNPRRQFDEA
ELQDLASSIRQHGIVQPVVVRTIGSDRYEIIAGERRWRAAQLAGFTEIPVIVRDVDDRTA
LEIAIVENVQRSDLNPLEEALGYEQLIAEHGYTQNDLGDIIGKSRSHVANSLRLLKLPEP
VRDMLSDGSLSAGHARALIPTSDPVALARAVVAKGLSVREVERLAQNDIRSQNDPNYAKA
RQRDEKDADTLALERTLSDSLGLEVTVNHKASGGHLKITYKTLDQLEEICRLLERR
Download sequence
Identical sequences A6UEE5
gi|150398393|ref|YP_001328860.1| WP_012067406.1.29075 WP_012067406.1.61285 WP_012067406.1.7720 WP_012067406.1.89664 YP_001328860.1.44884 366394.Smed_3201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]