SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398474|ref|YP_001328941.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398474|ref|YP_001328941.1|
Domain Number 1 Region: 6-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.84e-85
Family ABC transporter ATPase domain-like 0.000000487
Further Details:      
 
Domain Number 2 Region: 239-344
Classification Level Classification E-value
Superfamily MOP-like 0.00000000000578
Family ABC-transporter additional domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398474|ref|YP_001328941.1|
Sequence length 350
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MTKGSVKFENVTKSYGEFVALKPLSIDIAPGTLCTLLGPSGCGKTTTLRLIAGLESATAG
RILIGGQDVTHLSATYRPVSMVFQSYALFPHMTVLENVAYGLSVKRVPKAEAKDRAETGL
ELVGLSGFGSRLPSELSGGQQQRVAVARAIVLEPEVLLLDEPLSNLDAKLRRHVREEIRQ
IQQRLELTAVYVTHDQEEAMAVSDRIIVMKNAEIAQEGTPHDLYERPASAFIADFIGDAN
LLDTEVIATGDETRIRLLGQELTLPLTAKHTGAAKLVLRPHQVRIGSETLPGSLPAEVTY
AAYLGNQIQYTLKSEAGEIFAVAPPVAQPFRQGDNVHFSWADNAPRIVMT
Download sequence
Identical sequences A6UEM6
gi|150398474|ref|YP_001328941.1| WP_012067487.1.29075 WP_012067487.1.61285 WP_012067487.1.7720 YP_001328941.1.44884 366394.Smed_3284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]