SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398503|ref|YP_001328970.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398503|ref|YP_001328970.1|
Domain Number 1 Region: 110-228
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-25
Family Aromatic dioxygenase reductase-like 0.0049
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.61e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0046
Further Details:      
 
Domain Number 3 Region: 215-314
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.31e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398503|ref|YP_001328970.1|
Sequence length 321
Comment ferredoxin [Sinorhizobium medicae WSM419]
Sequence
MSGGTEIPVRVTKVTPVAHRIKRFRFERLDGRPMPYFSGGAHVIVSMNDNGHLRRNAYSL
MSPPYDCSAYEISVLHVDDSRGGSSFMHEKVREGDEMRVSHPVNLFQPDWRGRKHLLIAG
GIGITPFIAMMEQFSREGAQFELHYAIRSRDRGAYCEDLVAHYGRHRVKIYCDAEDNRIP
VARLLDSQPLGTHLYVCGPAGLIDGVLKSGLESGWPEQNLHSERFLSSQPGKPFSIELTR
SGKTVHVGHHESMLEAIESAGVDAPFLCRGGACGQCETRVALCDGKLLHNDVYLTDEEKA
SGRKVMLCVSRFEGKALHLDL
Download sequence
Identical sequences A6UEQ5
gi|150398503|ref|YP_001328970.1| WP_012067516.1.7720 YP_001328970.1.44884 366394.Smed_3313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]