SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398534|ref|YP_001329001.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398534|ref|YP_001329001.1|
Domain Number 1 Region: 3-116,236-406
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.42e-74
Family DeoB catalytic domain-like 0.0000244
Further Details:      
 
Domain Number 2 Region: 120-235
Classification Level Classification E-value
Superfamily DeoB insert domain-like 2.62e-48
Family DeoB insert domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150398534|ref|YP_001329001.1|
Sequence length 406
Comment phosphopentomutase [Sinorhizobium medicae WSM419]
Sequence
MARAFLFVLDSFGIGNAPDAGAFGDLGADTLGHIAEFCAAGAADRAGLREGPLNLPNMSA
LGLMHAARLATGRLPAGMALPERVYGVYGAASEVSRGKDTPSGHWEIAGTPVTFDWGYFP
ADGDAFPPELVEAICREGDVPGILGNCHASGTDIIARLGEEHMRTGKPICYTSSDSVFQI
AAHEQTFGLERLQDLCAVVRRLVDEYNIGRVIARPFVGSDPGSFTRTGNRRDYSVLPPAP
TVLDRLKEAGRTVHAIGKIADIFAHQGVTRLTKANGNMALFDASLAAIDEAEDGALIFTN
FVDFDMLYGHRRDVAGYAAALEAFDARLPDLDRRLKPGDMVILTADHGCDPTWRGTDHTR
ERVPVLMFGPTLRSRSVGIVGSFAHIGETVASHLGIDPGPHGRSLI
Download sequence
Identical sequences A6UET6
gi|150398534|ref|YP_001329001.1| 366394.Smed_3345 WP_012067547.1.29075 WP_012067547.1.61285 WP_012067547.1.7720 WP_012067547.1.89664 YP_001329001.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]